SCOP 1.71: Domain d7adh_2: 7adh 164-339

Lineage for d7adh_2 (7adh 164-339)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [51738] (34 PDB entries)

8. Domain d7adh_2: 7adh 164-339 [29724]
   Other proteins in same PDB: d7adh_1
   complexed with zn

Details for d7adh_2

PDB Entry: 7adh, 3.2 Å

PDB Description: three-dimensional structure of isonicotinimidylated liver alcohol dehydrogenase

SCOP Domain Sequences for d7adh_2:

Sequence; same for both SEQRES and ATOM records:

>d7adh_2 c.2.1.1 (164-339) Alcohol dehydrogenase {Horse (Equus caballus)}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

Timeline for d7adh_2:

• d7adh_2 first appeared (with stable ids) in SCOP 1.55
  
• d7adh_2 appears in SCOP 1.69
  
• d7adh_2 is called d7adha2 in SCOP 1.73
  
• d7adh_2 appears in the current release, SCOPe 2.08, called d7adha2