Lineage for d7adh_2 (7adh 175-324)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 19979Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 19980Protein Alcohol dehydrogenase [51737] (4 species)
  7. 19984Species Horse (Equus caballus) [TaxId:9796] [51738] (22 PDB entries)
  8. 20030Domain d7adh_2: 7adh 175-324 [29724]
    Other proteins in same PDB: d7adh_1

Details for d7adh_2

PDB Entry: 7adh (more details), 3.2 Å

PDB Description: three-dimensional structure of isonicotinimidylated liver alcohol dehydrogenase
PDB Compounds: ( :)

SCOP Domain Sequences for d7adh_2:

Sequence, based on SEQRES records: (download)

>d7adh_2 c.2.1.1 (175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavxvaxvtqgstcavfglggvglsvimgcxaagaariigvdinxdxfaxake
vgatecvnpqdyxkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

Sequence, based on observed residues (ATOM records): (download)

>d7adh_2 c.2.1.1 (175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavvavtqgstcavfglggvglsvimgcaagaariigvdindfaakevgatec
vnpqdykpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgvppdsqnl
smnpmlllsgrtwkgaifggfks

SCOP Domain Coordinates for d7adh_2:

Click to download the PDB-style file with coordinates for d7adh_2.
(The format of our PDB-style files is described here.)

Timeline for d7adh_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7adh_1