Lineage for d1adf_2 (1adf 175-324)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 19979Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 19980Protein Alcohol dehydrogenase [51737] (4 species)
  7. 19984Species Horse (Equus caballus) [TaxId:9796] [51738] (22 PDB entries)
  8. 20023Domain d1adf_2: 1adf 175-324 [29717]
    Other proteins in same PDB: d1adf_1

Details for d1adf_2

PDB Entry: 1adf (more details), 2.9 Å

PDB Description: crystallographic studies of two alcohol dehydrogenase-bound analogs of thiazole-4-carboxamide adenine dinucleotide (tad), the active anabolite of the antitumor agent tiazofurin

SCOP Domain Sequences for d1adf_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adf_2 c.2.1.1 (175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

SCOP Domain Coordinates for d1adf_2:

Click to download the PDB-style file with coordinates for d1adf_2.
(The format of our PDB-style files is described here.)

Timeline for d1adf_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1adf_1