SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ldyd2 (1ldy D:164-339)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090220Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 protein domains)
    N-terminal all-beta domain defines family
  6. 2090241Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2090258Species Horse (Equus caballus) [TaxId:9796] [51738] (46 PDB entries)
    Uniprot P00327
  8. 2090337Domain d1ldyd2: 1ldy D:164-339 [29714]
    Other proteins in same PDB: d1ldya1, d1ldyb1, d1ldyc1, d1ldyd1
    complexed with cxf, nad, zn

Details for d1ldyd2

PDB Entry: 1ldy (more details), 2.5 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and cyclohexyl formamide (cxf)
PDB Compounds: (D:) alcohol dehydrogenase

SCOPe Domain Sequences for d1ldyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldyd2 c.2.1.1 (D:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d1ldyd2:

Click to download the PDB-style file with coordinates for d1ldyd2.
(The format of our PDB-style files is described here.)

Timeline for d1ldyd2: