Lineage for d1ldyd2 (1ldy D:164-339)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841027Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2841044Species Horse (Equus caballus) [TaxId:9796] [51738] (53 PDB entries)
    Uniprot P00327
  8. 2841144Domain d1ldyd2: 1ldy D:164-339 [29714]
    Other proteins in same PDB: d1ldya1, d1ldyb1, d1ldyc1, d1ldyd1
    complexed with cxf, nad, zn

Details for d1ldyd2

PDB Entry: 1ldy (more details), 2.5 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and cyclohexyl formamide (cxf)
PDB Compounds: (D:) alcohol dehydrogenase

SCOPe Domain Sequences for d1ldyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldyd2 c.2.1.1 (D:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d1ldyd2:

Click to download the PDB-style file with coordinates for d1ldyd2.
(The format of our PDB-style files is described here.)

Timeline for d1ldyd2: