Lineage for d1axga2 (1axg A:175-324)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 19979Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 19980Protein Alcohol dehydrogenase [51737] (4 species)
  7. 19984Species Horse (Equus caballus) [TaxId:9796] [51738] (22 PDB entries)
  8. 20012Domain d1axga2: 1axg A:175-324 [29707]
    Other proteins in same PDB: d1axga1, d1axgb1, d1axgc1, d1axgd1

Details for d1axga2

PDB Entry: 1axg (more details), 2.5 Å

PDB Description: crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution

SCOP Domain Sequences for d1axga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axga2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggaglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

SCOP Domain Coordinates for d1axga2:

Click to download the PDB-style file with coordinates for d1axga2.
(The format of our PDB-style files is described here.)

Timeline for d1axga2: