SCOP 1.63: Domain d8adh_2: 8adh 175-324

Lineage for d8adh_2 (8adh 175-324)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (6 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (5 species)

7. Species Horse (Equus caballus) [TaxId:9796] [51738] (30 PDB entries)

8. Domain d8adh_2: 8adh 175-324 [29706]
   Other proteins in same PDB: d8adh_1
   complexed with zn

Details for d8adh_2

PDB Entry: 8adh, 2.4 Å

PDB Description: interdomain motion in liver alcohol dehydrogenase. structural and energetic analysis of the hinge bending mode

SCOP Domain Sequences for d8adh_2:

Sequence; same for both SEQRES and ATOM records:

>d8adh_2 c.2.1.1 (175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

Timeline for d8adh_2:

• d8adh_2 first appeared (with stable ids) in SCOP 1.55
  
• d8adh_2 appears in SCOP 1.61
  
• d8adh_2 appears in SCOP 1.65
  
• d8adh_2 appears in the current release, SCOPe 2.08, called d8adha2