SCOP 1.59: Domain d1ldeb2: 1lde B:175-324

Lineage for d1ldeb2 (1lde B:175-324)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)

6. Protein Alcohol dehydrogenase [51737] (4 species)

7. Species Horse (Equus caballus) [TaxId:9796] [51738] (26 PDB entries)

8. Domain d1ldeb2: 1lde B:175-324 [29703]
   Other proteins in same PDB: d1ldea1, d1ldeb1, d1ldec1, d1lded1

Details for d1ldeb2

PDB Entry: 1lde, 2.5 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and n-formyl piperdine

SCOP Domain Sequences for d1ldeb2:

Sequence; same for both SEQRES and ATOM records:

>d1ldeb2 c.2.1.1 (B:175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

Timeline for d1ldeb2:

• d1ldeb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ldeb2 appears in SCOP 1.57
  
• d1ldeb2 appears in SCOP 1.61
  
• d1ldeb2 appears in the current release, SCOPe 2.08