| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
| Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (6 proteins) N-terminal all-beta domain defines family |
| Protein Alcohol dehydrogenase [51737] (5 species) |
| Species Horse (Equus caballus) [TaxId:9796] [51738] (30 PDB entries) |
| Domain d1axeb2: 1axe B:175-324 [29698] Other proteins in same PDB: d1axea1, d1axeb1 complexed with etf, nad, zn; mutant |
PDB Entry: 1axe (more details), 2 Å
SCOP Domain Sequences for d1axeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axeb2 c.2.1.1 (B:175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks
Timeline for d1axeb2: