SCOP 1.61: Domain d1axeb2: 1axe B:175-324

Lineage for d1axeb2 (1axe B:175-324)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)

6. Protein Alcohol dehydrogenase [51737] (4 species)

7. Species Horse (Equus caballus) [TaxId:9796] [51738] (26 PDB entries)

8. Domain d1axeb2: 1axe B:175-324 [29698]
   Other proteins in same PDB: d1axea1, d1axeb1

Details for d1axeb2

PDB Entry: 1axe, 2 Å

PDB Description: crystal structure of the active-site mutant phe93->trp of horse liver alcohol dehydrogenase in complex with nad and inhibitor trifluoroethanol

SCOP Domain Sequences for d1axeb2:

Sequence; same for both SEQRES and ATOM records:

>d1axeb2 c.2.1.1 (B:175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

Timeline for d1axeb2:

• d1axeb2 first appeared (with stable ids) in SCOP 1.55
  
• d1axeb2 appears in SCOP 1.59
  
• d1axeb2 appears in SCOP 1.63
  
• d1axeb2 appears in the current release, SCOPe 2.08