Lineage for d1axea2 (1axe A:175-324)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 117974Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 117975Protein Alcohol dehydrogenase [51737] (4 species)
  7. 117979Species Horse (Equus caballus) [TaxId:9796] [51738] (26 PDB entries)
  8. 118000Domain d1axea2: 1axe A:175-324 [29697]
    Other proteins in same PDB: d1axea1, d1axeb1

Details for d1axea2

PDB Entry: 1axe (more details), 2 Å

PDB Description: crystal structure of the active-site mutant phe93->trp of horse liver alcohol dehydrogenase in complex with nad and inhibitor trifluoroethanol

SCOP Domain Sequences for d1axea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axea2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

SCOP Domain Coordinates for d1axea2:

Click to download the PDB-style file with coordinates for d1axea2.
(The format of our PDB-style files is described here.)

Timeline for d1axea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axea1