Lineage for d1btob2 (1bto B:175-324)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66137Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 66138Protein Alcohol dehydrogenase [51737] (4 species)
  7. 66142Species Horse (Equus caballus) [TaxId:9796] [51738] (26 PDB entries)
  8. 66166Domain d1btob2: 1bto B:175-324 [29694]
    Other proteins in same PDB: d1btoa1, d1btob1, d1btoc1, d1btod1

Details for d1btob2

PDB Entry: 1bto (more details), 2 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3r)3-butylthiolane 1-oxide
PDB Compounds: (B:)

SCOP Domain Sequences for d1btob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btob2 c.2.1.1 (B:175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

SCOP Domain Coordinates for d1btob2:

Click to download the PDB-style file with coordinates for d1btob2.
(The format of our PDB-style files is described here.)

Timeline for d1btob2: