SCOP 1.55: Domain d1btoa2: 1bto A:175-324

Lineage for d1btoa2 (1bto A:175-324)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families)

5. Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)

6. Protein Alcohol dehydrogenase [51737] (4 species)

7. Species Horse (Equus caballus) [TaxId:9796] [51738] (22 PDB entries)

8. Domain d1btoa2: 1bto A:175-324 [29693]
   Other proteins in same PDB: d1btoa1, d1btob1, d1btoc1, d1btod1

Details for d1btoa2

PDB Entry: 1bto, 2 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3r)3-butylthiolane 1-oxide

SCOP Domain Sequences for d1btoa2:

Sequence; same for both SEQRES and ATOM records:

>d1btoa2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

Timeline for d1btoa2:

• d1btoa2 appears in SCOP 1.57
  
• d1btoa2 appears in the current release, SCOPe 2.08