Lineage for d1a71b2 (1a71 B:175-324)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175019Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 175020Protein Alcohol dehydrogenase [51737] (4 species)
  7. 175024Species Horse (Equus caballus) [TaxId:9796] [51738] (26 PDB entries)
  8. 175040Domain d1a71b2: 1a71 B:175-324 [29690]
    Other proteins in same PDB: d1a71a1, d1a71b1

Details for d1a71b2

PDB Entry: 1a71 (more details), 2 Å

PDB Description: ternary complex of an active site double mutant of horse liver alcohol dehydrogenase, phe93=>trp, val203=>ala with nad and trifluoroethanol

SCOP Domain Sequences for d1a71b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a71b2 c.2.1.1 (B:175-324) Alcohol dehydrogenase {Horse (Equus caballus)}
gfstgygsavkvakvtqgstcavfglggaglsvimgckaagaariigvdinkdkfakake
vgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccqeaygvsvivgv
ppdsqnlsmnpmlllsgrtwkgaifggfks

SCOP Domain Coordinates for d1a71b2:

Click to download the PDB-style file with coordinates for d1a71b2.
(The format of our PDB-style files is described here.)

Timeline for d1a71b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a71b1