Lineage for d1a71a2 (1a71 A:164-339)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 685977Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 685995Protein Alcohol dehydrogenase [51737] (9 species)
  7. 686023Species Horse (Equus caballus) [TaxId:9796] [51738] (36 PDB entries)
  8. 686066Domain d1a71a2: 1a71 A:164-339 [29689]
    Other proteins in same PDB: d1a71a1, d1a71b1

Details for d1a71a2

PDB Entry: 1a71 (more details), 2 Å

PDB Description: ternary complex of an active site double mutant of horse liver alcohol dehydrogenase, phe93=>trp, val203=>ala with nad and trifluoroethanol
PDB Compounds: (A:) liver alcohol dehydrogenase

SCOP Domain Sequences for d1a71a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a71a2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggaglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOP Domain Coordinates for d1a71a2:

Click to download the PDB-style file with coordinates for d1a71a2.
(The format of our PDB-style files is described here.)

Timeline for d1a71a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a71a1