Lineage for d2oxib2 (2oxi B:164-339)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. Protein Alcohol dehydrogenase [51737] (9 species)
  7. Species Horse (Equus caballus) [TaxId:9796] [51738] (52 PDB entries)
    Uniprot P00327
  8. Domain d2oxib2: 2oxi B:164-339 [29688]
    Other proteins in same PDB: d2oxia1, d2oxib1
    complexed with cu, dms, nad, zn

Details for d2oxib2

PDB Entry: 2oxi (more details), 2.1 Å

PDB Description: refined crystal structure of cu-substituted alcohol dehydrogenase at 2.1 angstroms resolution
PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d2oxib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxib2 c.2.1.1 (B:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d2oxib2 are not available.

Timeline for d2oxib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oxib1
View in 3D
Domains from other chains:
(mouse over for more information)
d2oxia1, d2oxia2