Lineage for d2ohxa2 (2ohx A:164-339)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102559Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 2102580Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2102597Species Horse (Equus caballus) [TaxId:9796] [51738] (46 PDB entries)
    Uniprot P00327
  8. 2102643Domain d2ohxa2: 2ohx A:164-339 [29685]
    Other proteins in same PDB: d2ohxa1, d2ohxb1
    complexed with dms, nad, zn

Details for d2ohxa2

PDB Entry: 2ohx (more details), 1.8 Å

PDB Description: refined crystal structure of liver alcohol dehydrogenase-nadh complex at 1.8 angstroms resolution
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d2ohxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohxa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

SCOPe Domain Coordinates for d2ohxa2:

Click to download the PDB-style file with coordinates for d2ohxa2.
(The format of our PDB-style files is described here.)

Timeline for d2ohxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ohxa1