SCOPe 2.08: Domain d3btob2: 3bto B:164-339

Lineage for d3btob2 (3bto B:164-339)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [51738] (53 PDB entries)
   Uniprot P00327

8. Domain d3btob2: 3bto B:164-339 [29682]
   Other proteins in same PDB: d3btoa1, d3btob1, d3btoc1, d3btod1
   complexed with nad, ssb, zn

Details for d3btob2

PDB Entry: 3bto, 1.66 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3s)3-butylthiolane 1-oxide

PDB Compounds: (B:) liver alcohol dehydrogenase

SCOPe Domain Sequences for d3btob2:

Sequence; same for both SEQRES and ATOM records:

>d3btob2 c.2.1.1 (B:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

Timeline for d3btob2:

• d3btob2 first appeared (with stable ids) in SCOP 1.55
  
• d3btob2 appears in SCOPe 2.07