Lineage for d1b5ta_ (1b5t A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2449058Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2449059Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 proteins)
    automatically mapped to Pfam PF02219
  6. 2449060Protein Methylenetetrahydrofolate reductase [51732] (2 species)
  7. 2449061Species Escherichia coli [TaxId:562] [51733] (7 PDB entries)
  8. 2449074Domain d1b5ta_: 1b5t A: [29676]
    complexed with fad, hg

Details for d1b5ta_

PDB Entry: 1b5t (more details), 2.5 Å

PDB Description: escherichia coli methylenetetrahydrofolate reductase
PDB Compounds: (A:) protein (methylenetetrahydrofolate reductase)

SCOPe Domain Sequences for d1b5ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5ta_ c.1.23.1 (A:) Methylenetetrahydrofolate reductase {Escherichia coli [TaxId: 562]}
gqinvsfeffpprtsemeqtlwnsidrlsslkpkfvsvtygansgerdrthsiikgikdr
tgleaaphltcidatpdelrtiardywnngirhivalrgdlppgsgkpemyasdlvtllk
evadfdisvaaypevhpeaksaqadllnlkrkvdaganraitqfffdvesylrfrdrcvs
agidveiipgilpvsnfkqakkfadmtnvripawmaqmfdgldddaetrklvganiamdm
vkilsregvkdfhfytlnraemsyaichtlgvrpa

SCOPe Domain Coordinates for d1b5ta_:

Click to download the PDB-style file with coordinates for d1b5ta_.
(The format of our PDB-style files is described here.)

Timeline for d1b5ta_: