Lineage for d1f6ya_ (1f6y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089788Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 protein domains)
  6. 2089807Protein Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR [51724] (1 species)
  7. 2089808Species Moorella thermoacetica [TaxId:1525] [51725] (1 PDB entry)
  8. 2089809Domain d1f6ya_: 1f6y A: [29673]

Details for d1f6ya_

PDB Entry: 1f6y (more details), 2.2 Å

PDB Description: mad crystal structure analysis of methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase (metr)
PDB Compounds: (A:) 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase

SCOPe Domain Sequences for d1f6ya_:

Sequence, based on SEQRES records: (download)

>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]}
mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
qqikmladpapktvlglsnvsqncqnrplinrtflamamacglmsaiadacdealietaa
taeillnqtvycdsfvkmfktr

Sequence, based on observed residues (ATOM records): (download)

>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]}
mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgdkvsamewlvevt
qevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaaligltm
nktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktlqqik
mladpapktvlglsnvsqncqnrplinrtflamamacglmsaiadacdealietaataei
llnqtvycdsfvkmfktr

SCOPe Domain Coordinates for d1f6ya_:

Click to download the PDB-style file with coordinates for d1f6ya_.
(The format of our PDB-style files is described here.)

Timeline for d1f6ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f6yb_