Lineage for d1eyea_ (1eye A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19946Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families) (S)
  5. 19947Family c.1.21.1: Dihydropteroate synthetase [51718] (1 protein)
  6. 19948Protein Dihydropteroate synthetase [51719] (3 species)
  7. 19953Species Mycobacterium tuberculosis [TaxId:1773] [51722] (1 PDB entry)
  8. 19954Domain d1eyea_: 1eye A: [29672]

Details for d1eyea_

PDB Entry: 1eye (more details), 1.7 Å

PDB Description: 1.7 angstrom resolution crystal structure of 6-hydroxymethyl-7,8- dihydropteroate synthase (dhps) from mycobacterium tuberculosis in complex with 6-hydroxymethylpterin monophosphate

SCOP Domain Sequences for d1eyea_:

Sequence, based on SEQRES records: (download)

>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis}
pvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggessrpgatrvdpav
etsrvipvvkelaaqgitvsidtmradvaraalqngaqmvndvsggradpamgpllaead
vpwvlmhwravsadtphvpvrygnvvaevradllasvadavaagvdparlvldpglgfak
taqhnwailhalpelvatgipvlvgasrkrflgallagpdgvmrptdgrdtatavisala
alhgawgvrvhdvrasvdaikvveawmgae

Sequence, based on observed residues (ATOM records): (download)

>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis}
pvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggetsrvipvvkelaa
qgitvsidtmradvaraalqngaqmvndvsggradpamgpllaeadvpwvlmhwravsad
tphvpvrygnvvaevradllasvadavaagvdparlvldpglgfaktaqhnwailhalpe
lvatgipvlvgasrkrflgallagpdgvmrptdgrdtatavisalaalhgawgvrvhdvr
asvdaikvveawmgae

SCOP Domain Coordinates for d1eyea_:

Click to download the PDB-style file with coordinates for d1eyea_.
(The format of our PDB-style files is described here.)

Timeline for d1eyea_: