Lineage for d1eyea_ (1eye A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089691Protein Dihydropteroate synthetase [51719] (4 species)
  7. 2089765Species Mycobacterium tuberculosis [TaxId:1773] [51722] (1 PDB entry)
  8. 2089766Domain d1eyea_: 1eye A: [29672]
    complexed with mg, pmm

Details for d1eyea_

PDB Entry: 1eye (more details), 1.7 Å

PDB Description: 1.7 angstrom resolution crystal structure of 6-hydroxymethyl-7,8- dihydropteroate synthase (dhps) from mycobacterium tuberculosis in complex with 6-hydroxymethylpterin monophosphate
PDB Compounds: (A:) dihydropteroate synthase I

SCOPe Domain Sequences for d1eyea_:

Sequence, based on SEQRES records: (download)

>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]}
pvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggessrpgatrvdpav
etsrvipvvkelaaqgitvsidtmradvaraalqngaqmvndvsggradpamgpllaead
vpwvlmhwravsadtphvpvrygnvvaevradllasvadavaagvdparlvldpglgfak
taqhnwailhalpelvatgipvlvgasrkrflgallagpdgvmrptdgrdtatavisala
alhgawgvrvhdvrasvdaikvveawmgae

Sequence, based on observed residues (ATOM records): (download)

>d1eyea_ c.1.21.1 (A:) Dihydropteroate synthetase {Mycobacterium tuberculosis [TaxId: 1773]}
pvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggetsrvipvvkelaa
qgitvsidtmradvaraalqngaqmvndvsggradpamgpllaeadvpwvlmhwravsad
tphvpvrygnvvaevradllasvadavaagvdparlvldpglgfaktaqhnwailhalpe
lvatgipvlvgasrkrflgallagpdgvmrptdgrdtatavisalaalhgawgvrvhdvr
asvdaikvveawmgae

SCOPe Domain Coordinates for d1eyea_:

Click to download the PDB-style file with coordinates for d1eyea_.
(The format of our PDB-style files is described here.)

Timeline for d1eyea_: