Lineage for d1ad4a_ (1ad4 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19946Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families) (S)
  5. 19947Family c.1.21.1: Dihydropteroate synthetase [51718] (1 protein)
  6. 19948Protein Dihydropteroate synthetase [51719] (3 species)
  7. 19955Species Staphylococcus aureus [TaxId:1280] [51721] (2 PDB entries)
  8. 19958Domain d1ad4a_: 1ad4 A: [29670]

Details for d1ad4a_

PDB Entry: 1ad4 (more details), 2.4 Å

PDB Description: dihydropteroate synthetase complexed with oh-ch2-pterin-pyrophosphate from staphylococcus aureus

SCOP Domain Sequences for d1ad4a_:

Sequence, based on SEQRES records: (download)

>d1ad4a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus}
tktkimgilnvtpdsfsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve
eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky
daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae
vmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvh
nvelnaklakgidflkenenarh

Sequence, based on observed residues (ATOM records): (download)

>d1ad4a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus}
tktkimgilnvnvesavtrvkammdegadiidvggvstrpghemitveeelnrvlpvvea
ivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvakydaeivlmhngng
nrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeaevmarldelvate
ypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvhnvelnaklakgi
dflkenenarh

SCOP Domain Coordinates for d1ad4a_:

Click to download the PDB-style file with coordinates for d1ad4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ad4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ad4b_