Lineage for d1ad1a_ (1ad1 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1345907Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 1345908Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 1345909Protein Dihydropteroate synthetase [51719] (4 species)
  7. 1345973Species Staphylococcus aureus [TaxId:1280] [51721] (2 PDB entries)
  8. 1345974Domain d1ad1a_: 1ad1 A: [29668]
    complexed with k, trs

Details for d1ad1a_

PDB Entry: 1ad1 (more details), 2.2 Å

PDB Description: dihydropteroate synthetase (apo form) from staphylococcus aureus
PDB Compounds: (A:) dihydropteroate synthetase

SCOPe Domain Sequences for d1ad1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]}
tktkimgilnvtpdsfsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve
eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky
daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae
vmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvh
nvelnaklakgidflkenenarhn

SCOPe Domain Coordinates for d1ad1a_:

Click to download the PDB-style file with coordinates for d1ad1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ad1a_: