![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) ![]() |
![]() | Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
![]() | Protein Dihydropteroate synthetase [51719] (4 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [51721] (2 PDB entries) |
![]() | Domain d1ad1a_: 1ad1 A: [29668] complexed with k, trs |
PDB Entry: 1ad1 (more details), 2.2 Å
SCOPe Domain Sequences for d1ad1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} tktkimgilnvtpdsfsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae vmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvh nvelnaklakgidflkenenarhn
Timeline for d1ad1a_: