Lineage for d1ad1a_ (1ad1 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307797Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families) (S)
  5. 307798Family c.1.21.1: Dihydropteroate synthetase [51718] (1 protein)
  6. 307799Protein Dihydropteroate synthetase [51719] (3 species)
  7. 307806Species Staphylococcus aureus [TaxId:1280] [51721] (2 PDB entries)
  8. 307807Domain d1ad1a_: 1ad1 A: [29668]

Details for d1ad1a_

PDB Entry: 1ad1 (more details), 2.2 Å

PDB Description: dihydropteroate synthetase (apo form) from staphylococcus aureus

SCOP Domain Sequences for d1ad1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus}
tktkimgilnvtpdsfsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve
eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky
daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae
vmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvh
nvelnaklakgidflkenenarhn

SCOP Domain Coordinates for d1ad1a_:

Click to download the PDB-style file with coordinates for d1ad1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ad1a_: