Lineage for d1ad1a_ (1ad1 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) 
Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) Protein Dihydropteroate synthetase [51719] (5 species) 
Species Staphylococcus aureus [TaxId:1280] [51721] (2 PDB entries) 
Domain d1ad1a_: 1ad1 A: [29668]
complexed with k, trs
Details for d1ad1a_
PDB Entry: 1ad1 (more details), 2.2 Å
PDB Description: dihydropteroate synthetase (apo form) from staphylococcus aureus
PDB Compounds: (A:) dihydropteroate synthetaseSCOPe Domain Sequences for d1ad1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]}
tktkimgilnvtpdsfsdggkfnnvesavtrvkammdegadiidvggvstrpghemitve
eelnrvlpvveaivgfdvkisvdtfrsevaeaclklgvdiindqwaglydhrmfqvvaky
daeivlmhngngnrdepvveemltsllaqahqakiagipsnkiwldpgigfaktrneeae
vmarldelvateypvllatsrkrftkemmgydttpverdevtaattaygimkgvravrvh
nvelnaklakgidflkenenarhn
SCOPe Domain Coordinates for d1ad1a_:
Click to download the PDB-style file with coordinates for d1ad1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ad1a_:
- d1ad1a_ first appeared (with stable ids) in SCOP 1.55
- d1ad1a_ appears in SCOPe 2.07
View in 3D
