SCOPe 2.07: Domain d1aj0a_: 1aj0 A:

Lineage for d1aj0a_ (1aj0 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)

6. Protein Dihydropteroate synthetase [51719] (5 species)

7. Species Escherichia coli [TaxId:562] [51720] (3 PDB entries)

8. Domain d1aj0a_: 1aj0 A: [29667]
   complexed with ph2, san, so4

Details for d1aj0a_

PDB Entry: 1aj0, 2 Å

PDB Description: crystal structure of a ternary complex of e. coli dihydropteroate synthase

PDB Compounds: (A:) dihydropteroate synthase

SCOPe Domain Sequences for d1aj0a_:

Sequence; same for both SEQRES and ATOM records:

>d1aj0a_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]}
mklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvgge
strpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirsl
sepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiake
kllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgsl
acaviaamqgahiirvhdvketveamrvveatlsakenkrye

Timeline for d1aj0a_:

• d1aj0a_ first appeared (with stable ids) in SCOP 1.55, called d1aj0__
  
• d1aj0a_ appears in SCOPe 2.06
  
• d1aj0a_ appears in the current release, SCOPe 2.08