Lineage for d1aj0__ (1aj0 -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19946Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families) (S)
  5. 19947Family c.1.21.1: Dihydropteroate synthetase [51718] (1 protein)
  6. 19948Protein Dihydropteroate synthetase [51719] (3 species)
  7. 19949Species Escherichia coli [TaxId:562] [51720] (3 PDB entries)
  8. 19952Domain d1aj0__: 1aj0 - [29667]

Details for d1aj0__

PDB Entry: 1aj0 (more details), 2 Å

PDB Description: crystal structure of a ternary complex of e. coli dihydropteroate synthase

SCOP Domain Sequences for d1aj0__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aj0__ c.1.21.1 (-) Dihydropteroate synthetase {Escherichia coli}
mklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvgge
strpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirsl
sepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiake
kllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgsl
acaviaamqgahiirvhdvketveamrvveatlsakenkrye

SCOP Domain Coordinates for d1aj0__:

Click to download the PDB-style file with coordinates for d1aj0__.
(The format of our PDB-style files is described here.)

Timeline for d1aj0__: