SCOP 1.63: Domain d1aj2__: 1aj2 -

Lineage for d1aj2__ (1aj2 -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (2 families)

5. Family c.1.21.1: Dihydropteroate synthetase [51718] (1 protein)

6. Protein Dihydropteroate synthetase [51719] (3 species)

7. Species Escherichia coli [TaxId:562] [51720] (3 PDB entries)

8. Domain d1aj2__: 1aj2 - [29665]
   complexed with 2ph, so4

Details for d1aj2__

PDB Entry: 1aj2, 2 Å

PDB Description: crystal structure of a binary complex of e. coli dihydropteroate synthase

SCOP Domain Sequences for d1aj2__:

Sequence; same for both SEQRES and ATOM records:

>d1aj2__ c.1.21.1 (-) Dihydropteroate synthetase {Escherichia coli}
mklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvgge
strpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirsl
sepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiake
kllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgsl
acaviaamqgahiirvhdvketveamrvveatlsakenkrye

Timeline for d1aj2__:

• d1aj2__ first appeared (with stable ids) in SCOP 1.55
  
• d1aj2__ appears in SCOP 1.61
  
• d1aj2__ appears in SCOP 1.65
  
• d1aj2__ appears in the current release, SCOPe 2.08, called d1aj2a_