Lineage for d1wkda_ (1wkd A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448538Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2448539Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 2448550Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2448579Species Zymomonas mobilis [TaxId:542] [51716] (156 PDB entries)
    Uniprot P28720
  8. 2448732Domain d1wkda_: 1wkd A: [29664]
    complexed with zn

Details for d1wkda_

PDB Entry: 1wkd (more details), 2.6 Å

PDB Description: trna-guanine transglycosylase
PDB Compounds: (A:) tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1wkda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkda_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltasggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOPe Domain Coordinates for d1wkda_:

Click to download the PDB-style file with coordinates for d1wkda_.
(The format of our PDB-style files is described here.)

Timeline for d1wkda_: