Lineage for d1wkd__ (1wkd -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19935Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 19936Family c.1.20.1: tRNA-guanine transglycosylase [51714] (1 protein)
  6. 19937Protein tRNA-guanine transglycosylase [51715] (1 species)
  7. 19938Species Zymomonas mobilis [TaxId:542] [51716] (7 PDB entries)
  8. 19945Domain d1wkd__: 1wkd - [29664]

Details for d1wkd__

PDB Entry: 1wkd (more details), 2.6 Å

PDB Description: trna-guanine transglycosylase

SCOP Domain Sequences for d1wkd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkd__ c.1.20.1 (-) tRNA-guanine transglycosylase {Zymomonas mobilis}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltasggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOP Domain Coordinates for d1wkd__:

Click to download the PDB-style file with coordinates for d1wkd__.
(The format of our PDB-style files is described here.)

Timeline for d1wkd__: