Lineage for d1enua_ (1enu A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 476697Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 476698Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 476709Protein Queosine tRNA-guanine transglycosylase [51715] (1 species)
    contains zinc-binding subdomain
  7. 476710Species Zymomonas mobilis [TaxId:542] [51716] (24 PDB entries)
  8. 476730Domain d1enua_: 1enu A: [29660]

Details for d1enua_

PDB Entry: 1enu (more details), 1.95 Å

PDB Description: a new target for shigellosis: rational design and crystallographic studies of inhibitors of trna-guanine transglycosylase

SCOP Domain Sequences for d1enua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enua_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOP Domain Coordinates for d1enua_:

Click to download the PDB-style file with coordinates for d1enua_.
(The format of our PDB-style files is described here.)

Timeline for d1enua_: