Lineage for d1diol_ (1dio L:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 66029Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (3 families) (S)
  5. 66070Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (1 protein)
  6. 66071Protein Diol dehydratase, alpha subunit [51711] (1 species)
  7. 66072Species Klebsiella oxytoca [TaxId:571] [51712] (4 PDB entries)
  8. 66080Domain d1diol_: 1dio L: [29657]
    Other proteins in same PDB: d1diob_, d1dioe_, d1diog_, d1diom_

Details for d1diol_

PDB Entry: 1dio (more details), 2.2 Å

PDB Description: diol dehydratase-cyanocobalamin complex from klebsiella oxytoca

SCOP Domain Sequences for d1diol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diol_ c.1.19.3 (L:) Diol dehydratase, alpha subunit {Klebsiella oxytoca}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpn

SCOP Domain Coordinates for d1diol_:

Click to download the PDB-style file with coordinates for d1diol_.
(The format of our PDB-style files is described here.)

Timeline for d1diol_: