Lineage for d1egml_ (1egm L:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19883Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (3 families) (S)
  5. 19924Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (1 protein)
  6. 19925Protein Diol dehydratase, alpha subunit [51711] (1 species)
  7. 19926Species Klebsiella oxytoca [TaxId:571] [51712] (4 PDB entries)
  8. 19932Domain d1egml_: 1egm L: [29655]
    Other proteins in same PDB: d1egmb_, d1egme_, d1egmg_, d1egmm_

Details for d1egml_

PDB Entry: 1egm (more details), 1.85 Å

PDB Description: crystal structure of diol dehydratase-cyanocobalamin complex at 100k.

SCOP Domain Sequences for d1egml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egml_ c.1.19.3 (L:) Diol dehydratase, alpha subunit {Klebsiella oxytoca}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpn

SCOP Domain Coordinates for d1egml_:

Click to download the PDB-style file with coordinates for d1egml_.
(The format of our PDB-style files is described here.)

Timeline for d1egml_: