Lineage for d1eexl_ (1eex L:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19883Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (3 families) (S)
  5. 19924Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (1 protein)
  6. 19925Protein Diol dehydratase, alpha subunit [51711] (1 species)
  7. 19926Species Klebsiella oxytoca [TaxId:571] [51712] (4 PDB entries)
  8. 19928Domain d1eexl_: 1eex L: [29651]
    Other proteins in same PDB: d1eexb_, d1eexe_, d1eexg_, d1eexm_

Details for d1eexl_

PDB Entry: 1eex (more details), 1.7 Å

PDB Description: crystal structure of the diol dehydratase-adeninylpentylcobalamin complex from klebsiella oxytoca

SCOP Domain Sequences for d1eexl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eexl_ c.1.19.3 (L:) Diol dehydratase, alpha subunit {Klebsiella oxytoca}
mrskrfealakrpvnqdgfvkewieegfiamespndpkpsikivngavteldgkpvsdfd
lidhfiaryginlnraeevmamdsvklanmlcdpnvkrseivplttamtpakivevvshm
nvvemmmamqkmrarrtpsqqahvtnvkdnpvqiaadaaegawrgfdeqettvavaryap
fnaiallvgsqvgrpgvltqcsleeatelklgmlghtcyaetisvygtepvftdgddtpw
skgflassyasrglkmrftsgsgsevqmgyaegksmlylearciyitkaagvqglqngsv
scigvpsavpsgiravlaenlicssldlecassndqtfthsdmrrtarllmqflpgtdfi
ssgysavpnydnmfagsnedaedfddynviqrdlkvdgglrpvreedviairnkaaralq
avfagmglppitdeeveaatyahgskdmpernivedikfaqeiinknrnglevvkalaqg
gftdvaqdmlniqkakltgdylhtsaiivgdgqvlsavndvndyagpatgyrlqgerwee
iknipgaldpn

SCOP Domain Coordinates for d1eexl_:

Click to download the PDB-style file with coordinates for d1eexl_.
(The format of our PDB-style files is described here.)

Timeline for d1eexl_: