Lineage for d1cb7d_ (1cb7 D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 66029Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (3 families) (S)
  5. 66063Family c.1.19.2: Glutamate mutase, large subunit [51707] (1 protein)
  6. 66064Protein Glutamate mutase, large subunit [51708] (1 species)
  7. 66065Species Clostridium cochlearium [TaxId:1494] [51709] (2 PDB entries)
  8. 66069Domain d1cb7d_: 1cb7 D: [29649]
    Other proteins in same PDB: d1cb7a_, d1cb7c_

Details for d1cb7d_

PDB Entry: 1cb7 (more details), 2 Å

PDB Description: glutamate mutase from clostridium cochlearium reconstituted with methyl-cobalamin

SCOP Domain Sequences for d1cb7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb7d_ c.1.19.2 (D:) Glutamate mutase, large subunit {Clostridium cochlearium}
melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
llngfpgvnfgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
rpe

SCOP Domain Coordinates for d1cb7d_:

Click to download the PDB-style file with coordinates for d1cb7d_.
(The format of our PDB-style files is described here.)

Timeline for d1cb7d_: