SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1cb7b_ (1cb7 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089512Family c.1.19.2: Glutamate mutase, large subunit [51707] (1 protein)
    automatically mapped to Pfam PF06368
  6. 2089513Protein Glutamate mutase, large subunit [51708] (1 species)
  7. 2089514Species Clostridium cochlearium [TaxId:1494] [51709] (3 PDB entries)
  8. 2089519Domain d1cb7b_: 1cb7 B: [29648]
    Other proteins in same PDB: d1cb7a_, d1cb7c_
    complexed with cob, tar

Details for d1cb7b_

PDB Entry: 1cb7 (more details), 2 Å

PDB Description: glutamate mutase from clostridium cochlearium reconstituted with methyl-cobalamin
PDB Compounds: (B:) protein (glutamate mutase)

SCOPe Domain Sequences for d1cb7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb7b_ c.1.19.2 (B:) Glutamate mutase, large subunit {Clostridium cochlearium [TaxId: 1494]}
melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
llngfpgvnfgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
rpe

SCOPe Domain Coordinates for d1cb7b_:

Click to download the PDB-style file with coordinates for d1cb7b_.
(The format of our PDB-style files is described here.)

Timeline for d1cb7b_: