Lineage for d1ccwb_ (1ccw B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19883Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (3 families) (S)
  5. 19917Family c.1.19.2: Glutamate mutase, large subunit [51707] (1 protein)
  6. 19918Protein Glutamate mutase, large subunit [51708] (1 species)
  7. 19919Species Clostridium cochlearium [TaxId:1494] [51709] (2 PDB entries)
  8. 19920Domain d1ccwb_: 1ccw B: [29646]
    Other proteins in same PDB: d1ccwa_, d1ccwc_

Details for d1ccwb_

PDB Entry: 1ccw (more details), 1.6 Å

PDB Description: structure of the coenzyme b12 dependent enzyme glutamate mutase from clostridium cochlearium

SCOP Domain Sequences for d1ccwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccwb_ c.1.19.2 (B:) Glutamate mutase, large subunit {Clostridium cochlearium}
melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
llngfpgvnfgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
rpe

SCOP Domain Coordinates for d1ccwb_:

Click to download the PDB-style file with coordinates for d1ccwb_.
(The format of our PDB-style files is described here.)

Timeline for d1ccwb_: