Lineage for d1ccwb_ (1ccw B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089512Family c.1.19.2: Glutamate mutase, large subunit [51707] (1 protein)
    automatically mapped to Pfam PF06368
  6. 2089513Protein Glutamate mutase, large subunit [51708] (1 species)
  7. 2089514Species Clostridium cochlearium [TaxId:1494] [51709] (3 PDB entries)
  8. 2089515Domain d1ccwb_: 1ccw B: [29646]
    Other proteins in same PDB: d1ccwa_, d1ccwc_
    complexed with cnc, tar

Details for d1ccwb_

PDB Entry: 1ccw (more details), 1.6 Å

PDB Description: structure of the coenzyme b12 dependent enzyme glutamate mutase from clostridium cochlearium
PDB Compounds: (B:) protein (glutamate mutase)

SCOPe Domain Sequences for d1ccwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccwb_ c.1.19.2 (B:) Glutamate mutase, large subunit {Clostridium cochlearium [TaxId: 1494]}
melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
llngfpgvnfgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
rpe

SCOPe Domain Coordinates for d1ccwb_:

Click to download the PDB-style file with coordinates for d1ccwb_.
(The format of our PDB-style files is described here.)

Timeline for d1ccwb_: