Lineage for d3reqb1 (3req B:16-475)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386774Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (3 families) (S)
  5. 386775Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 proteins)
    the subunits are clearly related but only one (alpha) is active
  6. 386793Protein Methylmalonyl-CoA mutase beta subunit, domain 1 [88711] (1 species)
    the subunits are clearly related but only one (alpha) is active
  7. 386794Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88712] (8 PDB entries)
  8. 386809Domain d3reqb1: 3req B:16-475 [29645]
    Other proteins in same PDB: d3reqa1, d3reqa2, d3reqb2
    complexed with aco; mutant

Details for d3reqb1

PDB Entry: 3req (more details), 2.7 Å

PDB Description: methylmalonyl-coa mutase, substrate-free state (poor quality structure)

SCOP Domain Sequences for d3reqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3reqb1 c.1.19.1 (B:16-475) Methylmalonyl-CoA mutase beta subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii}
ltpttlslagdfpkateeqwerevekvlnrgrppekqltfaeclkrltvhtvdgidivpm
yrpkdapkklgypgvapftrgttvrngdmdawdvralhedpdekftrkaileglergvts
lllrvdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvsvyersdkpakdlal
nlgldpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniyhnagagdvaelawa
latgaeyvralveqgftateafdtinfrvtathdqfltiarlralreawarigevfgvde
dkrgarqnaitswreltredpyvnilrgsiatfsasvggaesittlpftqalglpeddfp
lriarntgivlaeevnigrvndpaggsyyvesltrsladaawkefqeveklggmskavmt
ehvtkvldacnaerakrlanrkqpitavsefpmigarsie

SCOP Domain Coordinates for d3reqb1:

Click to download the PDB-style file with coordinates for d3reqb1.
(The format of our PDB-style files is described here.)

Timeline for d3reqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3reqb2