Lineage for d2reqc1 (2req C:4-560)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089477Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 protein domains)
    the subunits are clearly related but only one (alpha) is active
    automatically mapped to Pfam PF01642
  6. 2089478Protein Methylmalonyl-CoA mutase alpha subunit, domain 1 [88709] (1 species)
  7. 2089479Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88710] (8 PDB entries)
  8. 2089493Domain d2reqc1: 2req C:4-560 [29642]
    Other proteins in same PDB: d2reqa2, d2reqb1, d2reqb2, d2reqc2, d2reqd1, d2reqd2
    complexed with b12, coa

Details for d2reqc1

PDB Entry: 2req (more details), 2.5 Å

PDB Description: methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state
PDB Compounds: (C:) methylmalonyl-coa mutase

SCOPe Domain Sequences for d2reqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2reqc1 c.1.19.1 (C:4-560) Methylmalonyl-CoA mutase alpha subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
lprfdsvdlgnapvpadaarrfeelaakagtgeawetaeqipvgtlfnedvykdmdwldt
yagippfvhgpyatmyafrpwtirqyagfstakesnafyrrnlaagqkglsvafdlpthr
gydsdnprvagdvgmagvaidsiydmrelfagipldqmsvsmtmngavlpilalyvvtae
eqgvkpeqlagtiqndilkefmvrntyiyppqpsmriiseifaytsanmpkwnsisisgy
hmqeagatadiemaytladgvdyiragesvglnvdqfaprlsffwgigmnffmevaklra
armlwaklvhqfgpknpksmslrthsqtsgwsltaqdvynnvvrtcieamaatqghtqsl
htnsldeaialptdfsariarntqlflqqesgttrvidpwsgsayveeltwdlarkawgh
iqevekvggmakaiekgipkmrieeaaartqaridsgrqpligvnkyrleheppldvlkv
dnstvlaeqkaklvklraerdpekvkaaldkitwaagnpddkdpdrnllklcidagrama
tvgemsdalekvfgryt

SCOPe Domain Coordinates for d2reqc1:

Click to download the PDB-style file with coordinates for d2reqc1.
(The format of our PDB-style files is described here.)

Timeline for d2reqc1: