Lineage for d2reqb1 (2req B:17-475)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840022Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2840023Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 proteins)
    the subunits are clearly related but only one (alpha) is active
    automatically mapped to Pfam PF01642
  6. 2840041Protein Methylmalonyl-CoA mutase beta subunit, domain 1 [88711] (1 species)
    the subunits are clearly related but only one (alpha) is active
  7. 2840042Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88712] (8 PDB entries)
  8. 2840053Domain d2reqb1: 2req B:17-475 [29641]
    Other proteins in same PDB: d2reqa1, d2reqa2, d2reqb2, d2reqc1, d2reqc2, d2reqd2
    complexed with b12, coa

Details for d2reqb1

PDB Entry: 2req (more details), 2.5 Å

PDB Description: methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state
PDB Compounds: (B:) methylmalonyl-coa mutase

SCOPe Domain Sequences for d2reqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2reqb1 c.1.19.1 (B:17-475) Methylmalonyl-CoA mutase beta subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
tpttlslagdfpkateeqwerevekvlnrgrppekqltfaeclkrltvhtvdgidivpmy
rpkdapkklgypgvapftrgttvrngdmdawdvralhedpdekftrkaileglergvtsl
llrvdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvsvyersdkpakdlaln
lgldpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniyhnagagdvaelawal
atgaeyvralveqgftateafdtinfrvtathdqfltiarlralreawarigevfgvded
krgarqnaitswreltredpyvnilrgsiatfsasvggaesittlpftqalglpeddfpl
riarntgivlaeevnigrvndpaggsyyvesltrsladaawkefqeveklggmskavmte
hvtkvldacnaerakrlanrkqpitavsefpmigarsie

SCOPe Domain Coordinates for d2reqb1:

Click to download the PDB-style file with coordinates for d2reqb1.
(The format of our PDB-style files is described here.)

Timeline for d2reqb1: