SCOPe 2.08: Domain d2reqb1: 2req B:17-475

Lineage for d2reqb1 (2req B:17-475)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families)

5. Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 proteins)
   the subunits are clearly related but only one (alpha) is active
   automatically mapped to Pfam PF01642

6. Protein Methylmalonyl-CoA mutase beta subunit, domain 1 [88711] (1 species)
   the subunits are clearly related but only one (alpha) is active

7. Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88712] (8 PDB entries)

8. Domain d2reqb1: 2req B:17-475 [29641]
   Other proteins in same PDB: d2reqa1, d2reqa2, d2reqb2, d2reqc1, d2reqc2, d2reqd2
   complexed with b12, coa

Details for d2reqb1

PDB Entry: 2req, 2.5 Å

PDB Description: methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state

PDB Compounds: (B:) methylmalonyl-coa mutase

SCOPe Domain Sequences for d2reqb1:

Sequence; same for both SEQRES and ATOM records:

>d2reqb1 c.1.19.1 (B:17-475) Methylmalonyl-CoA mutase beta subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
tpttlslagdfpkateeqwerevekvlnrgrppekqltfaeclkrltvhtvdgidivpmy
rpkdapkklgypgvapftrgttvrngdmdawdvralhedpdekftrkaileglergvtsl
llrvdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvsvyersdkpakdlaln
lgldpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniyhnagagdvaelawal
atgaeyvralveqgftateafdtinfrvtathdqfltiarlralreawarigevfgvded
krgarqnaitswreltredpyvnilrgsiatfsasvggaesittlpftqalglpeddfpl
riarntgivlaeevnigrvndpaggsyyvesltrsladaawkefqeveklggmskavmte
hvtkvldacnaerakrlanrkqpitavsefpmigarsie

Timeline for d2reqb1:

• d2reqb1 first appeared (with stable ids) in SCOP 1.55
  
• d2reqb1 appears in SCOPe 2.07