SCOPe 2.08: Domain d5reqd1: 5req D:20-475

Lineage for d5reqd1 (5req D:20-475)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families)

5. Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 proteins)
   the subunits are clearly related but only one (alpha) is active
   automatically mapped to Pfam PF01642

6. Protein Methylmalonyl-CoA mutase beta subunit, domain 1 [88711] (1 species)
   the subunits are clearly related but only one (alpha) is active

7. Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88712] (8 PDB entries)

8. Domain d5reqd1: 5req D:20-475 [29635]
   Other proteins in same PDB: d5reqa1, d5reqa2, d5reqb2, d5reqc1, d5reqc2, d5reqd2
   complexed with b12, gol, mcd, scd; mutant

Details for d5reqd1

PDB Entry: 5req, 2.2 Å

PDB Description: methylmalonyl-coa mutase, y89f mutant, substrate complex

PDB Compounds: (D:) protein (methylmalonyl-coa mutase beta-subunit)

SCOPe Domain Sequences for d5reqd1:

Sequence; same for both SEQRES and ATOM records:

>d5reqd1 c.1.19.1 (D:20-475) Methylmalonyl-CoA mutase beta subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
tlslagdfpkateeqwerevekvlnrgrppekqltfaeclkrltvhtvdgidivpmyrpk
dapkklgypgvapftrgttvrngdmdawdvralhedpdekftrkaileglergvtslllr
vdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvsvyersdkpakdlalnlgl
dpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniyhnagagdvaelawalatg
aeyvralveqgftateafdtinfrvtathdqfltiarlralreawarigevfgvdedkrg
arqnaitswreltredpyvnilrgsiatfsasvggaesittlpftqalglpeddfplria
rntgivlaeevnigrvndpaggsyyvesltrsladaawkefqeveklggmskavmtehvt
kvldacnaerakrlanrkqpitavsefpmigarsie

Timeline for d5reqd1:

• d5reqd1 first appeared (with stable ids) in SCOP 1.55
  
• d5reqd1 appears in SCOPe 2.07