Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) |
Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 proteins) the subunits are clearly related but only one (alpha) is active automatically mapped to Pfam PF01642 |
Protein Methylmalonyl-CoA mutase alpha subunit, domain 1 [88709] (1 species) |
Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88710] (8 PDB entries) |
Domain d5reqc1: 5req C:4-560 [29634] Other proteins in same PDB: d5reqa2, d5reqb1, d5reqb2, d5reqc2, d5reqd1, d5reqd2 complexed with b12, gol, mcd, scd; mutant |
PDB Entry: 5req (more details), 2.2 Å
SCOPe Domain Sequences for d5reqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5reqc1 c.1.19.1 (C:4-560) Methylmalonyl-CoA mutase alpha subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} lprfdsvdlgnapvpadaarrfeelaakagtgeawetaeqipvgtlfnedvykdmdwldt yagippfvhgpyatmyafrpwtirqfagfstakesnafyrrnlaagqkglsvafdlpthr gydsdnprvagdvgmagvaidsiydmrelfagipldqmsvsmtmngavlpilalyvvtae eqgvkpeqlagtiqndilkefmvrntyiyppqpsmriiseifaytsanmpkwnsisisgy hmqeagatadiemaytladgvdyiragesvglnvdqfaprlsffwgigmnffmevaklra armlwaklvhqfgpknpksmslrthsqtsgwsltaqdvynnvvrtcieamaatqghtqsl htnsldeaialptdfsariarntqlflqqesgttrvidpwsgsayveeltwdlarkawgh iqevekvggmakaiekgipkmrieeaaartqaridsgrqpligvnkyrleheppldvlkv dnstvlaeqkaklvklraerdpekvkaaldkitwaagnpddkdpdrnllklcidagrama tvgemsdalekvfgryt
Timeline for d5reqc1: