Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.2: Chorismate mutase [55304] (1 protein) automatically mapped to Pfam PF07736 |
Protein Chorismate mutase [55305] (3 species) |
Species Bacillus subtilis [TaxId:1423] [55306] (10 PDB entries) |
Domain d3zopf_: 3zop F: [296266] automated match to d1dbfa_ |
PDB Entry: 3zop (more details), 1.61 Å
SCOPe Domain Sequences for d3zopf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zopf_ d.79.1.2 (F:) Chorismate mutase {Bacillus subtilis [TaxId: 1423]} mmirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpak avrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqeqirhvylekavvlrp
Timeline for d3zopf_: