![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) ![]() automatically mapped to Pfam PF04627 |
![]() | Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins) |
![]() | Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310956] (5 PDB entries) |
![]() | Domain d3zias_: 3zia S: [296223] Other proteins in same PDB: d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziaf1, d3ziaf2, d3ziaf3, d3ziag_, d3ziah1, d3ziah2, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3, d3ziaq_, d3ziar1, d3ziar2 automated match to d2hldi_ complexed with adp, atp, edo, mg |
PDB Entry: 3zia (more details), 2.5 Å
SCOPe Domain Sequences for d3zias_:
Sequence, based on SEQRES records: (download)
>d3zias_ a.137.8.1 (S:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit k
>d3zias_ a.137.8.1 (S:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqyknaseptpitk
Timeline for d3zias_:
![]() Domains from other chains: (mouse over for more information) d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziaf1, d3ziaf2, d3ziaf3, d3ziag_, d3ziah1, d3ziah2, d3ziai_, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3, d3ziaq_, d3ziar1, d3ziar2 |