Lineage for d3zias_ (3zia S:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733879Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) (S)
    automatically mapped to Pfam PF04627
  5. 2733880Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)
  6. 2733881Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species)
  7. 2733882Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310956] (5 PDB entries)
  8. 2733893Domain d3zias_: 3zia S: [296223]
    Other proteins in same PDB: d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziaf1, d3ziaf2, d3ziaf3, d3ziag_, d3ziah1, d3ziah2, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3, d3ziaq_, d3ziar1, d3ziar2
    automated match to d2hldi_
    complexed with adp, atp, edo, mg

Details for d3zias_

PDB Entry: 3zia (more details), 2.5 Å

PDB Description: the structure of f1-atpase from saccharomyces cerevisiae inhibited by its regulatory protein if1
PDB Compounds: (S:) ATP synthase subunit epsilon, mitochondrial

SCOPe Domain Sequences for d3zias_:

Sequence, based on SEQRES records: (download)

>d3zias_ a.137.8.1 (S:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
k

Sequence, based on observed residues (ATOM records): (download)

>d3zias_ a.137.8.1 (S:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqyknaseptpitk

SCOPe Domain Coordinates for d3zias_:

Click to download the PDB-style file with coordinates for d3zias_.
(The format of our PDB-style files is described here.)

Timeline for d3zias_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziaf1, d3ziaf2, d3ziaf3, d3ziag_, d3ziah1, d3ziah2, d3ziai_, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3, d3ziaq_, d3ziar1, d3ziar2