SCOPe 2.06: Domain d3ziar1: 3zia R:11-90

Lineage for d3ziar1 (3zia R:11-90)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
   delta subunit in mitochondria

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310954] (5 PDB entries)

8. Domain d3ziar1: 3zia R:11-90 [296221]
   Other proteins in same PDB: d3ziaa1, d3ziaa2, d3ziaa3, d3ziab1, d3ziab2, d3ziab3, d3ziac1, d3ziac2, d3ziac3, d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziaf1, d3ziaf2, d3ziaf3, d3ziag_, d3ziah2, d3ziai_, d3ziak1, d3ziak2, d3ziak3, d3zial1, d3zial2, d3zial3, d3ziam1, d3ziam2, d3ziam3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3, d3ziaq_, d3ziar2, d3zias_
   automated match to d2hldh1
   complexed with adp, atp, edo, mg

Details for d3ziar1

PDB Entry: 3zia, 2.5 Å

PDB Description: the structure of f1-atpase from saccharomyces cerevisiae inhibited by its regulatory protein if1

PDB Compounds: (R:) ATP synthase subunit delta, mitochondrial

SCOPe Domain Sequences for d3ziar1:

Sequence, based on SEQRES records:

>d3ziar1 b.93.1.1 (R:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffi
sggfatvqpdsqlcvtaiea

Sequence, based on observed residues (ATOM records):

>d3ziar1 b.93.1.1 (R:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysvtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisgg
fatvqpdsqlcvtaiea

Timeline for d3ziar1:

• d3ziar1 is new in SCOPe 2.06-stable
  
• d3ziar1 appears in SCOPe 2.07
  
• d3ziar1 appears in the current release, SCOPe 2.08