Lineage for d1reqc1 (1req C:2-560)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089477Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 protein domains)
    the subunits are clearly related but only one (alpha) is active
    automatically mapped to Pfam PF01642
  6. 2089478Protein Methylmalonyl-CoA mutase alpha subunit, domain 1 [88709] (1 species)
  7. 2089479Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88710] (8 PDB entries)
  8. 2089483Domain d1reqc1: 1req C:2-560 [29622]
    Other proteins in same PDB: d1reqa2, d1reqb1, d1reqb2, d1reqc2, d1reqd1, d1reqd2
    complexed with b12, dca, gol

Details for d1reqc1

PDB Entry: 1req (more details), 2 Å

PDB Description: methylmalonyl-coa mutase
PDB Compounds: (C:) methylmalonyl-coa mutase

SCOPe Domain Sequences for d1reqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1reqc1 c.1.19.1 (C:2-560) Methylmalonyl-CoA mutase alpha subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
stlprfdsvdlgnapvpadaarrfeelaakagtgeawetaeqipvgtlfnedvykdmdwl
dtyagippfvhgpyatmyafrpwtirqyagfstakesnafyrrnlaagqkglsvafdlpt
hrgydsdnprvagdvgmagvaidsiydmrelfagipldqmsvsmtmngavlpilalyvvt
aeeqgvkpeqlagtiqndilkefmvrntyiyppqpsmriiseifaytsanmpkwnsisis
gyhmqeagatadiemaytladgvdyiragesvglnvdqfaprlsffwgigmnffmevakl
raarmlwaklvhqfgpknpksmslrthsqtsgwsltaqdvynnvvrtcieamaatqghtq
slhtnsldeaialptdfsariarntqlflqqesgttrvidpwsgsayveeltwdlarkaw
ghiqevekvggmakaiekgipkmrieeaaartqaridsgrqpligvnkyrleheppldvl
kvdnstvlaeqkaklvklraerdpekvkaaldkitwaagnpddkdpdrnllklcidagra
matvgemsdalekvfgryt

SCOPe Domain Coordinates for d1reqc1:

Click to download the PDB-style file with coordinates for d1reqc1.
(The format of our PDB-style files is described here.)

Timeline for d1reqc1: