Lineage for d3ziak2 (3zia K:97-376)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869484Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species)
  7. 2869487Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310928] (2 PDB entries)
  8. 2869500Domain d3ziak2: 3zia K:97-376 [296213]
    Other proteins in same PDB: d3ziaa1, d3ziaa3, d3ziab1, d3ziab3, d3ziac1, d3ziac3, d3ziad1, d3ziad2, d3ziad3, d3ziae1, d3ziae2, d3ziae3, d3ziaf1, d3ziaf2, d3ziaf3, d3ziag_, d3ziah1, d3ziah2, d3ziai_, d3ziak1, d3ziak3, d3zial1, d3zial3, d3ziam1, d3ziam3, d3zian1, d3zian2, d3zian3, d3ziao1, d3ziao2, d3ziao3, d3ziap1, d3ziap2, d3ziap3, d3ziaq_, d3ziar1, d3ziar2, d3zias_
    automated match to d2hlda2
    complexed with adp, atp, edo, mg

Details for d3ziak2

PDB Entry: 3zia (more details), 2.5 Å

PDB Description: the structure of f1-atpase from saccharomyces cerevisiae inhibited by its regulatory protein if1
PDB Compounds: (K:) ATP synthase subunit alpha, mitochondrial

SCOPe Domain Sequences for d3ziak2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ziak2 c.37.1.11 (K:97-376) Central domain of alpha subunit of F1 ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsvhepvqtglkavd
alvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycvyvavgqkrstva
qlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngkhalivyddlskq
avayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgsltalpvietqggdv
sayiptnvisitdgqifleaelfykgirpainvglsvsrv

SCOPe Domain Coordinates for d3ziak2:

Click to download the PDB-style file with coordinates for d3ziak2.
(The format of our PDB-style files is described here.)

Timeline for d3ziak2: