Lineage for d7reqd1 (7req D:16-475)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089477Family c.1.19.1: Methylmalonyl-CoA mutase, N-terminal (CoA-binding) domain [51704] (2 protein domains)
    the subunits are clearly related but only one (alpha) is active
    automatically mapped to Pfam PF01642
  6. 2089495Protein Methylmalonyl-CoA mutase beta subunit, domain 1 [88711] (1 species)
    the subunits are clearly related but only one (alpha) is active
  7. 2089496Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88712] (8 PDB entries)
  8. 2089498Domain d7reqd1: 7req D:16-475 [29619]
    Other proteins in same PDB: d7reqa1, d7reqa2, d7reqb2, d7reqc1, d7reqc2, d7reqd2
    complexed with 2cp, b12, gol

Details for d7reqd1

PDB Entry: 7req (more details), 2.2 Å

PDB Description: methylmalonyl-coa mutase, 2-carboxypropyl-coa inhibitor complex
PDB Compounds: (D:) protein (methylmalonyl-coa mutase)

SCOPe Domain Sequences for d7reqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7reqd1 c.1.19.1 (D:16-475) Methylmalonyl-CoA mutase beta subunit, domain 1 {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
ltpttlslagdfpkateeqwerevekvlnrgrppekqltfaeclkrltvhtvdgidivpm
yrpkdapkklgypgvapftrgttvrngdmdawdvralhedpdekftrkaileglergvts
lllrvdpdaiapehldevlsdvllemtkvevfsrydqgaaaealvsvyersdkpakdlal
nlgldpigfaalqgtepdltvlgdwvrrlakfspdsravtidaniyhnagagdvaelawa
latgaeyvralveqgftateafdtinfrvtathdqfltiarlralreawarigevfgvde
dkrgarqnaitswreltredpyvnilrgsiatfsasvggaesittlpftqalglpeddfp
lriarntgivlaeevnigrvndpaggsyyvesltrsladaawkefqeveklggmskavmt
ehvtkvldacnaerakrlanrkqpitavsefpmigarsie

SCOPe Domain Coordinates for d7reqd1:

Click to download the PDB-style file with coordinates for d7reqd1.
(The format of our PDB-style files is described here.)

Timeline for d7reqd1: