Lineage for d1aoda_ (1aod A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448305Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2448334Family c.1.18.2: Bacterial PLC [51699] (2 proteins)
  6. 2448335Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species)
  7. 2448346Species Listeria monocytogenes [TaxId:1639] [51702] (2 PDB entries)
  8. 2448348Domain d1aoda_: 1aod A: [29615]
    complexed with ins

Details for d1aoda_

PDB Entry: 1aod (more details), 2.6 Å

PDB Description: phosphatidylinositol-specific phospholipase c from listeria monocytogenes
PDB Compounds: (A:) phosphatidylinositol-specific phospholipase c

SCOPe Domain Sequences for d1aoda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoda_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Listeria monocytogenes [TaxId: 1639]}
vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry
idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq
pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq
viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf
vlnltsekvrglgilimdfpekqtikniiknnkf

SCOPe Domain Coordinates for d1aoda_:

Click to download the PDB-style file with coordinates for d1aoda_.
(The format of our PDB-style files is described here.)

Timeline for d1aoda_: