Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.2: Bacterial PLC [51699] (2 proteins) |
Protein Phosphatidylinositol-specific phospholipase C [51700] (2 species) |
Species Listeria monocytogenes [TaxId:1639] [51702] (2 PDB entries) |
Domain d1aoda_: 1aod A: [29615] complexed with ins |
PDB Entry: 1aod (more details), 2.6 Å
SCOPe Domain Sequences for d1aoda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoda_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Listeria monocytogenes [TaxId: 1639]} vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf vlnltsekvrglgilimdfpekqtikniiknnkf
Timeline for d1aoda_: